PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_15678_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 311aa    MW: 34629.7 Da    PI: 4.5953
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_15678_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89e-17245247
                                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         gr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  cra_locus_15678_iso_1_len_962_ver_3  2 GRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 45
                                         89*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.5E-13148IPR001005SANT/Myb domain
PROSITE profilePS5129423.096150IPR017930Myb domain
PfamPF002493.4E-15245IPR001005SANT/Myb domain
SuperFamilySSF466891.25E-13254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-22247IPR009057Homeodomain-like
CDDcd001671.42E-12346No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
XGRFSFEEEE TIIQLHSILG NKWSAIAARL PGRTDNEIKN YWNTHIRKRL LRMGIDPVTH  60
SPRLDLLDLS SILNTSVYGS SSSHNQMNLS RLLGLQPLVN PELLRLATSL LSSQRKNQDF  120
PILQNQSQQN QFYSNPQLEN HQLPPLVQDI PNCTATLSTT CPPTCTTMDT VPFSNVEQFS  180
SNLPNFNSEN CELNHWQNVG ANFXDFAALQ NYGYYGGGCG SGSEGQSMLD NIPTANSDTR  240
TTFQSNNSNN FSFQSVLSNL STPSSSPAPL NSSSTYINSS STTTEDDREI SYCSNLLKFE  300
IPDILDVNEF M
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801248.11e-109PREDICTED: protein ODORANT1-like
RefseqXP_011096186.11e-109PREDICTED: protein ODORANT1-like
RefseqXP_016465732.11e-109PREDICTED: protein ODORANT1-like
TrEMBLA0A110A0K91e-101A0A110A0K9_COFCA; R2R3-MYB transcription factor 102
STRINGPGSC0003DMT4000576904e-95(Solanum tuberosum)